PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Ctg14738g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 214aa    MW: 23513.8 Da    PI: 6.8586
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Ctg14738g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.43.4e-3351108260
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                               ++vrY+eClkNhA+ +GghavDGCg+fmp+ geegt++alkCaAC+CHRnFHR+eve e
  Niben101Ctg14738g00001.1  51 SSVRYRECLKNHAVGIGGHAVDGCGDFMPA-GEEGTMDALKCAACNCHRNFHRKEVEGE 108
                               679**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2346109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.8E-3053105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.1E-3054105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.38355104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.9E-8181214IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MEFDEEHEEQ EEEIGNIHQI SSAAATVNFQ IQGNNTVKGI EEGVSTNARK SSVRYRECLK  60
NHAVGIGGHA VDGCGDFMPA GEEGTMDALK CAACNCHRNF HRKEVEGEVF HHIPPTHLTH  120
HHPQPHHSHH PQFSPYTSYR TPHHPSGYLN VNPPHHQRPL ALPSTSREDE DMSNPSSSGG  180
GGGGSGGVGG SSRKRFRTKF TADQKDKMLA FAER
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758154.11e-104PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_016501975.11e-103PREDICTED: uncharacterized protein LOC107820239
SwissprotA2Z2592e-48ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLM1AZE89e-78M1AZE8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000336242e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-41homeobox protein 22